peptide t Search Results


d ala peptide t amide  (MedChemExpress)
92
MedChemExpress d ala peptide t amide
D Ala Peptide T Amide, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/d ala peptide t amide/product/MedChemExpress
Average 92 stars, based on 1 article reviews
d ala peptide t amide - by Bioz Stars, 2026-02
92/100 stars
  Buy from Supplier
cd8  (Biosynth Carbosynth)
93
Biosynth Carbosynth cd8
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Cd8, supplied by Biosynth Carbosynth, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/cd8/product/Biosynth Carbosynth
Average 93 stars, based on 1 article reviews
cd8 - by Bioz Stars, 2026-02
93/100 stars
  Buy from Supplier
ccr5 inhibitor dapta  (TargetMol)
94
TargetMol ccr5 inhibitor dapta
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Ccr5 Inhibitor Dapta, supplied by TargetMol, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ccr5 inhibitor dapta/product/TargetMol
Average 94 stars, based on 1 article reviews
ccr5 inhibitor dapta - by Bioz Stars, 2026-02
94/100 stars
  Buy from Supplier
peptide segment  (MedChemExpress)
93
MedChemExpress peptide segment
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Peptide Segment, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptide segment/product/MedChemExpress
Average 93 stars, based on 1 article reviews
peptide segment - by Bioz Stars, 2026-02
93/100 stars
  Buy from Supplier
sequence-scrambled version of the tethered peptide (t-scr)  (Janssen)
90
Janssen sequence-scrambled version of the tethered peptide (t-scr)
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Sequence Scrambled Version Of The Tethered Peptide (T Scr), supplied by Janssen, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sequence-scrambled version of the tethered peptide (t-scr)/product/Janssen
Average 90 stars, based on 1 article reviews
sequence-scrambled version of the tethered peptide (t-scr) - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
dapta is d-ala1-peptide t-amide, gmp quality dapta  (Bachem)
90
Bachem dapta is d-ala1-peptide t-amide, gmp quality dapta
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Dapta Is D Ala1 Peptide T Amide, Gmp Quality Dapta, supplied by Bachem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/dapta is d-ala1-peptide t-amide, gmp quality dapta/product/Bachem
Average 90 stars, based on 1 article reviews
dapta is d-ala1-peptide t-amide, gmp quality dapta - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
tc-peptide  (GenScript corporation)
90
GenScript corporation tc-peptide
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Tc Peptide, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tc-peptide/product/GenScript corporation
Average 90 stars, based on 1 article reviews
tc-peptide - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
peptide t  (Peninsula Laboratories)
90
Peninsula Laboratories peptide t
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Peptide T, supplied by Peninsula Laboratories, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptide t/product/Peninsula Laboratories
Average 90 stars, based on 1 article reviews
peptide t - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
standard peptide t-20 (ytslihslieesqnqqekneqelleldkwaslwnwf)  (GenScript corporation)
90
GenScript corporation standard peptide t-20 (ytslihslieesqnqqekneqelleldkwaslwnwf)
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Standard Peptide T 20 (Ytslihslieesqnqqekneqelleldkwaslwnwf), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/standard peptide t-20 (ytslihslieesqnqqekneqelleldkwaslwnwf)/product/GenScript corporation
Average 90 stars, based on 1 article reviews
standard peptide t-20 (ytslihslieesqnqqekneqelleldkwaslwnwf) - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
hr2derived peptide t-118 (10)  (Genemed Synthesis)
90
Genemed Synthesis hr2derived peptide t-118 (10)
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Hr2derived Peptide T 118 (10), supplied by Genemed Synthesis, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/hr2derived peptide t-118 (10)/product/Genemed Synthesis
Average 90 stars, based on 1 article reviews
hr2derived peptide t-118 (10) - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
trimeric cross-linked peptide [t n (iii)] # ¬t c (iii)  (Henkel Corporation)
90
Henkel Corporation trimeric cross-linked peptide [t n (iii)] # ¬t c (iii)
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
Trimeric Cross Linked Peptide [T N (Iii)] # ¬T C (Iii), supplied by Henkel Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/trimeric cross-linked peptide [t n (iii)] # ¬t c (iii)/product/Henkel Corporation
Average 90 stars, based on 1 article reviews
trimeric cross-linked peptide [t n (iii)] # ¬t c (iii) - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier
33 peptide t-cell stimulating cocktail qiagen prototype  (Qiagen)
90
Qiagen 33 peptide t-cell stimulating cocktail qiagen prototype
Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific <t>CD8</t> T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses <t>(TB10.3/.4)</t> by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.
33 Peptide T Cell Stimulating Cocktail Qiagen Prototype, supplied by Qiagen, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/33 peptide t-cell stimulating cocktail qiagen prototype/product/Qiagen
Average 90 stars, based on 1 article reviews
33 peptide t-cell stimulating cocktail qiagen prototype - by Bioz Stars, 2026-02
90/100 stars
  Buy from Supplier

Image Search Results


Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific CD8 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses (TB10.3/.4) by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.

Journal: Pathogens (Basel, Switzerland)

Article Title: Mycobacterium tuberculosis Central Metabolism Is Key Regulator of Macrophage Pyroptosis and Host Immunity.

doi: 10.3390/pathogens12091109

Figure Lengend Snippet: Figure 3. fdr mutants are more immunogenic in MΦ and in vivo. MSD MULTIARRAY analyses of mycobacteria-infected THP-1 supernatants for (A) IL-1β, (B) TNF-α, (C) IL-8, (D) IL-4, (E) IFN-γ, and (F) IL-12. Supernatants were collected on day 4 for analyses. Data are from three independent infections; means and standard deviations are shown. (A–E) For fdr infections, p < 0.05, relative to BCG parent control. (G) fdr mutants enhanced M. tuberculosis-specific CD4 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD4 responses (peptide-25) by IFN-γ ELISPOT. (H) fdr mutants enhanced M. tuberculosis-specific CD8 T-cell responses in vivo. C57BL/6 mice were subcutaneously immunized with fdr mutants or controls, and at 3 weeks post immunization, spleens were harvested and assayed for M. tuberculosis-specific CD8 responses (TB10.3/.4) by IFN-γ ELISPOT; 3 mice per group. (G,H) For fdr infections, p < 0.05, relative to BCG parent control.

Article Snippet: Then, 5 μg·mL−1 of peptide specific to mycobacterial CD4 (Peptide-25 (H2NFQDAYNAAGGHNAVF-OH, >85% purity, New England Peptide)) or CD8 (TB10.3/4 (H2N-QIMYNYPAM-OH, >85% purity, New England Peptide)) T-cell responses were added to ELISPOT plates.

Techniques: In Vivo, Infection, Control, Enzyme-linked Immunospot